Loading...
Statistics

Bravest Cigar
www.bravestcigar.com/
Advertisement

Bravestcigar.com

Home Conversion Technology Metas Server
Bravestcigar.com is hosted in United States / Provo . Bravestcigar.com uses HTTPS protocol. Number of used technologies: 10. First technologies: CSS, Flexslider, Google Font API, Number of used javascripts: 7. First javascripts: Jquery.js, Third-party.js, General.js, Number of used analytics tools: 0. Number of used plugins, modules: 1. Its server type is: nginx/1.10.0. Its CMS is: Wordpress.

Technologies in use by Bravestcigar.com

Technology

Number of occurences: 10
  • CSS
  • Flexslider
  • Google Font API
  • Html
  • Html5
  • Iframe
  • jQuery
  • Php
  • Pingback
  • Shortcodes

Advertisement

Javascripts

Number of occurences: 7
  • jquery.js
  • third-party.js
  • general.js
  • jquery.flexslider-min.js
  • featured-slider.js
  • gravityforms.js
  • conditional_logic.js

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • nginx/1.10.0

Used plugins, modules

Number of plugins and modules: 1
  • gravityforms

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Bravestcigar.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by HostGator.com, LLC./OU=PositiveSSL Wildcard/CN=*.hostgator.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by HostGator.com, LLC.
        • 2: PositiveSSL Wildcard
      • CN: *.hostgator.com
    • hash: dd92202f
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 33731708412500954451172688233094812607
    • validFrom: 151016000000Z
    • validTo: 181015235959Z
    • validFrom_time_t: 1444953600
    • validTo_time_t: 1539647999
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 4B:D0:EA:16:17:0D:DC:C2:CF:F0:DB:13:1E:B2:1C:3B:57:B2:F2:16
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.hostgator.com, DNS:hostgator.com

Meta - Bravestcigar.com

Number of occurences: 3
  • Name:
    Content: IE=edge,chrome=1
  • Name: generator
    Content: WooFramework 5.5.5
  • Name: viewport
    Content: initial-scale=1.0; maximum-scale=1.0; user-scalable=no

Server / Hosting

  • IP: 50.87.151.233
  • Latitude: 40.22
  • Longitude: -111.61
  • Country: United States
  • City: Provo

Rname

  • ns4043.hostgator.com
  • ns4044.hostgator.com
  • bravestcigar.com

Target

  • dnsadmin.gator2022.hostgator.com

HTTP Header Response

HTTP/1.1 200 OK Server: nginx/1.10.0 Date: Wed, 04 May 2016 13:38:01 GMT Content-Type: text/html; charset=UTF-8 X-Pingback: http://bravestcigar.com/xmlrpc.php X-Cache: MISS from s_ac3 X-Cache-Lookup: MISS from s_ac3:80 Via: 1.1 s_ac3 (squid/3.5.6) Connection: keep-alive

DNS

host: bravestcigar.com
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 50.87.151.233
host: bravestcigar.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns4043.hostgator.com
host: bravestcigar.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns4044.hostgator.com
host: bravestcigar.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns4043.hostgator.com
  5. rname: dnsadmin.gator2022.hostgator.com
  6. serial: 2016012900
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: bravestcigar.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: bravestcigar.com
host: bravestcigar.com
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 a mx include:websitewelcome.com ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ravestcigar.com, www.bqravestcigar.com, www.qravestcigar.com, www.bwravestcigar.com, www.wravestcigar.com, www.bzravestcigar.com, www.zravestcigar.com, www.bxravestcigar.com, www.xravestcigar.com, www.bravestcigar.com, www.ravestcigar.com, www.bsravestcigar.com, www.sravestcigar.com, www.byravestcigar.com, www.yravestcigar.com, www.beravestcigar.com, www.eravestcigar.com, www.bdravestcigar.com, www.dravestcigar.com, www.bcravestcigar.com, www.cravestcigar.com, www.bavestcigar.com, www.briavestcigar.com, www.biavestcigar.com, www.broavestcigar.com, www.boavestcigar.com, www.brlavestcigar.com, www.blavestcigar.com, www.brlavestcigar.com, www.blavestcigar.com, www.br.avestcigar.com, www.b.avestcigar.com, www.brvestcigar.com, www.braovestcigar.com, www.brovestcigar.com, www.brapvestcigar.com, www.brpvestcigar.com, www.bra9vestcigar.com, www.br9vestcigar.com, www.bravestcigar.com, www.brvestcigar.com, www.braivestcigar.com, www.brivestcigar.com, www.brauvestcigar.com, www.bruvestcigar.com, www.braestcigar.com, www.bravyestcigar.com, www.brayestcigar.com, www.bravzestcigar.com, www.brazestcigar.com, www.bravhestcigar.com, www.brahestcigar.com, www.bravnestcigar.com, www.branestcigar.com, www.bravmestcigar.com, www.bramestcigar.com, www.bravjestcigar.com, www.brajestcigar.com, www.bravkestcigar.com, www.brakestcigar.com, www.braviestcigar.com, www.braiestcigar.com, www.bravstcigar.com, www.bravexstcigar.com, www.bravxstcigar.com, www.bravesstcigar.com, www.bravsstcigar.com, www.bravewstcigar.com, www.bravwstcigar.com, www.braverstcigar.com, www.bravrstcigar.com, www.bravefstcigar.com, www.bravfstcigar.com, www.bravevstcigar.com, www.bravvstcigar.com, www.bravecstcigar.com, www.bravcstcigar.com, www.braveqstcigar.com, www.bravqstcigar.com, www.braveastcigar.com, www.bravastcigar.com, www.braveystcigar.com, www.bravystcigar.com, www.bravetcigar.com, www.bravesetcigar.com, www.braveetcigar.com, www.braveswtcigar.com, www.bravewtcigar.com, www.bravesdtcigar.com, www.bravedtcigar.com, www.bravesxtcigar.com, www.bravextcigar.com, www.bravesftcigar.com, www.braveftcigar.com, www.bravesgtcigar.com, www.bravegtcigar.com, www.bravesttcigar.com, www.bravettcigar.com, www.bravescigar.com, www.bravestqcigar.com, www.bravesqcigar.com, www.bravestacigar.com, www.bravesacigar.com, www.bravest cigar.com, www.braves cigar.com, www.bravestwcigar.com, www.braveswcigar.com, www.bravestecigar.com, www.bravesecigar.com, www.bravestzcigar.com, www.braveszcigar.com, www.bravestxcigar.com, www.bravesxcigar.com, www.bravestccigar.com, www.bravesccigar.com, www.bravestigar.com, www.bravestcdigar.com, www.bravestdigar.com, www.bravestcrigar.com, www.bravestrigar.com, www.bravestctigar.com, www.bravesttigar.com, www.bravestcvigar.com, www.bravestvigar.com, www.bravestcfigar.com, www.bravestfigar.com, www.bravestcgigar.com, www.bravestgigar.com, www.bravestchigar.com, www.bravesthigar.com, www.bravestcnigar.com, www.bravestnigar.com, www.bravestcmigar.com, www.bravestmigar.com, www.bravestcjigar.com, www.bravestjigar.com, www.bravestcgar.com, www.bravestcirgar.com, www.bravestcrgar.com, www.bravestcifgar.com, www.bravestcfgar.com, www.bravestcivgar.com, www.bravestcvgar.com, www.bravestcikgar.com, www.bravestckgar.com, www.bravestci,gar.com, www.bravestc,gar.com, www.bravestcibgar.com, www.bravestcbgar.com, www.bravestciggar.com, www.bravestcggar.com, www.bravestcitgar.com, www.bravestctgar.com, www.bravestciygar.com, www.bravestcygar.com, www.bravestciugar.com, www.bravestcugar.com, www.bravestcijgar.com, www.bravestcjgar.com, www.bravestcimgar.com, www.bravestcmgar.com, www.bravestcingar.com, www.bravestcngar.com,

Other Reviews

  1. Main Server
    Ann Arbor (United States) - 199.195.119.28
    Server software: nginx/1.0.15
    Technology: Html, Html5
    Number of Javascript: 3
    Number of meta tags: 1
  2. Amys Kinderpage
    Germany - 87.238.192.109
    Server software: Apache/2.2.17 (Unix) DAV/2 PHP/4.4.9 mod_fcgid/2.3.5
    Technology: Html
    Number of meta tags: 5
  3. DESIGN
    United Kingdom - 79.170.40.239
    Server software: Apache/2.4.23 (Unix)
    Technology: CSS, Html, Html5, Javascript
    Number of Javascript: 1
    Number of meta tags: 3
  4. 주식회사 코리아마님
    3D메쉬 매트 패드 방석
    Korea, Republic of - 211.233.51.142
    Server software: nginx
    Technology: CSS, Html, Iframe, Javascript, Php
    Number of Javascript: 11
    Number of meta tags: 4
  5. Medallion House - Build Your Dream Home
    Los Angeles (United States) - 198.252.106.73
    Server software: LiteSpeed
    Technology: CSS, Html, Html5, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 3
    Number of meta tags: 3
  6. legacycreekfarmscreenprinting.biz
    Road Town (Virgin Islands, British) - 208.91.197.39
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  7. Ken's Sporting Goods of Norco, California- Sporting Goods & Screen Printing Experts
    Welcome to Ken's Sporting Goods, serving California since 1976. Located in the Inland Empire Area. Specializing in Screen Printing, Custom Embroidery, Lettermans Jackets, School & Team Gear, Screen Printing for Clubs, Groups & Businesses, Graphic Designer On Staff, Custom Logos, Custom Tee-Shirts, Promotional Items, Featuring Top Brands, Special Order hard to find items are no problem for us. Visit Us Today ...
    Houston (United States) - 192.185.117.132
    Server software: nginx/1.10.1
    Technology: CSS, Html, Javascript, Swf Object, Google Analytics, StatCounter
    Number of Javascript: 4
    Number of meta tags: 11
  8. Parties in Trieste
    Click here to find parties located in Trieste in live
    Amsterdam (Netherlands) - 188.166.141.51
    G Analytics ID: UA-53637887-1
    Server software: nginx/1.4.6 (Ubuntu)
    Technology: BootstrapCDN, CSS, Font Awesome, Google Font API, Html, Html5, Iframe, Javascript, Php, Google Analytics, Google Publisher Tag, Taboola, Facebook Box
    Number of Javascript: 3
    Number of meta tags: 5
  9. Efeler Osgb | Ortak Sağlık ve İş Güvenliği Birimi İzmir
    Efeler Osgb İzmirde ortak sağlık ve iş güvenliği birimi olarak hizmet vermektedir.
    Turkey - 213.142.143.161
    Server software: nginx
    Technology: CSS, Flexslider, Html, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 11
    Number of meta tags: 5
  10. index
    Arezzo (Italy) - 31.11.32.118
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Html, Swf Object
    Number of meta tags: 1